Mouse Adiponectin (Acrp30)
Slide this table
| Cat-Nr. | M10-009 |
| Size | 25 µg |
| Price | 170 € |
| Source | Insect cells |
| Label | His-Tag |
| Formulation | lyophilized |
| Purity Confirmation | > 95% by SDS-PAGE & HPLC analyses |
| Length [aa] | 236 |
| Molecular Weight | 35.0 kDa |
| Endotoxin Levels | < 0.1 ng /mg of protein (<1EU/mg). |
| Biological Activity | Determined by a cytotoxic assay using M1 cells. The ED50 for this effect is 4.0-6.0 μg/ml. |
| Reconstitution | Centrifuge the vial prior to opening! |
| Synonyms | Adipoq; APN; Acdc; apM1; 30 kDa; GBP28; adipo; Acrp30 |
| Description | Adiponectin is an adipose-derived secreted protein containing 236 amino acid residues. It is relatively abundant in humans and rodents, accounting for about 0.01% of total plasma protein. The circulating levels of adiponectin are decreased under conditions of obesity, insulin resistance, and type II diabetes. Disruption of adiponectin in mice causes insulin resistance and neointimal formation. Conversely, administration of recombinant adiponectin suppresses hepatic glucose production, and reverses insulin resistance associated with both lipoatrophy and obesity. The protective role of adiponectin is attributed to its anti-inflammatory properties (e.g. ability to suppress expression of TNF-beta and class A scavenger receptor in macrophages). Recombinant adiponectin is a multimeric glycoprotein containing amino acids Val-21 to Asn-247 of the adiponectin precursor protein fused to an N-terminal histidine tag. Monomeric glycosylated adiponectin migrates at an apparent molecular weight of approximately 35.0 kDa by SDS PAGE analysis under reducing conditions. |
| Protein Sequence | RGHHHHHHHHVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN |
| Uniprot ID | Q60994 |
| Protein RefSeq | NP_033735.3 |
| mRNA RefSeq | NM_009605.4 |
All prices plus VAT + possible delivery charges