Human Lactogen, placental
Slide this table
Cat-Nr. | 500-035S |
Size | 10 µg |
Price | 190 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 192 |
Molecular Weight | 22.4 kDa |
N Terminal Sequence | AVQTVP |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg)< 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | Recombinant human PL is fully biologically active as evidenced by inducing proliferation of Nb2 cells. |
Species Reactivity | Human |
Reconstitution | It is recommended to reconstitute the lyophilized hPL in sterile water or 0.4% NaHCO3 adjusted tp pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein. |
Synonyms | Chorionic somatomammotropin hormone 1, Choriomammotropin, Placental lactogen (PL) |
Description | Recombinant human placental lactogen, one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 22.4 kDa, was purified by proprietary chromatographic techniques. |
Protein Sequence | AVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF |
Uniprot ID | P0DML2 |
Protein RefSeq | NP_001308.1 |
mRNA RefSeq | NM_001317.6 |
All prices plus VAT + possible delivery charges