Human I-TAC (CXCL11) (Animal Free)
Slide this table
Cat-Nr. | 100-058S-AF |
Size | 5 µg |
Price | 135 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
Length [aa] | 73 |
Molecular Weight | 8.3 kDa |
Endotoxin Levels | < 0.01 ng/ug of protein (< 0.1 EU/ug) |
Biological Activity | Determined by its ability to chemoattract human T-cells activated with IL-2. |
Species Reactivity | Hamster, Mouse, Rabbit, Human, Monkey |
Synonyms | CXCL11; IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B |
Description | I-TAC is a 'non-ELR' CXC chemokine that is regulated by interferon and signals through the CXCR3 receptor. I-TAC is chemoattractant for IL-2 activated T cells, but does not affect freshly isolated un-stimulated T cells, neutrophils, ormonocytes. Recombinant Human I-TAC (CXCL11) is an 8.3 kDa protein containing 73 amino acid residues, including the four highly conserved cysteine residues present in CXC chemokines. |
Protein Sequence | FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF |
Uniprot ID | O14625 |
Protein RefSeq | NP_005400.1 |
mRNA RefSeq | NM_005409.4 |
All prices plus VAT + possible delivery charges