Mouse Leptin pegylated super antagonist (mutant D23L/L39A/D40A/F41A)
Slide this table
Cat-Nr. | 500-051 |
Size | 100 µg |
Price | 390 € |
Source | E. coli |
Label | PEG |
Formulation | lyophilized |
Purity Confirmation | > 95.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 146 |
Molecular Weight | 35.6 KkDa |
N Terminal Sequence | AVPIQ |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg)< 0.1 ng/µg of protein (<1EU/µg)< 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | Pegylated recombinant super mouse leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. Pegylated recombinant super mouse leptin antagonist in vitro activity is 6-8 fold lower than the non-pegylated pegylated recombinant super mouse leptin antagonist but in vivo it has profound weight gain effect (as compared to the non-pegylated antagonist), resulting mainly from increased food intake. Its in vivo activity compared to that of PEG-MLA is 9-27 fold higher. |
Species Reactivity | Mouse |
Reconstitution | It is recommended to reconstitute the lyophilized pegylated recombinant super mouse leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
Synonyms | Lep; ob; obese |
Description | Mono-pegylated mouse super leptin antagonist (with 20 kDa PEG) is one polypeptide chain containing 146 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 35.6 kDa as determined by MS. However due to enlarged hydrodymanic volume pegylated recombinant super mouse leptin antagonist runs on the SDS-PAGE as a 55 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. Pegylated recombinant super mouse leptin antagonist half-life in circulation after SC injection was over 20 hours. Super mouse leptin antagonist (SMLA) was initially mutated, resulting in D23L/L39A/D40A/F41A mutant that was purified by proprietary chromatographic techniques. Its pegylation is similar to that described in Elinav et al. Endocrinology 150:3083-91 (2009) for pegylated recombinant mouse leptin antagonist. |
Protein Sequence | AVPIQKVQDDTKTLIKTIVTRINLISHTQSVSAKQRVTGAAAIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC |
Uniprot ID | P41160 |
Protein RefSeq | NP_032519.1 |
mRNA RefSeq | NM_008493.3 |
All prices plus VAT + possible delivery charges