Human VEGF-C
Slide this table
Cat-Nr. | 300-078 |
Size | 5 µg |
Price | 70 € |
Source | Insect cells |
Label | His-Tag |
Formulation | lyophilized |
Purity Confirmation | > 90% by SDS-PAGE |
Length [aa] | 121 |
Molecular Weight | 18.0-24.0 kDa |
N Terminal Sequence | DPTEETI |
Biological Activity | The biological activity was determined (i) by the ability to induce VEGFR-3/FLT-4 receptor phosphorylation in PAEC/VEGFR-3 cells and (ii) the VEGF-C-induced proliferation of primary human dermal lymphatic endothelial cells (HDLEC). |
Species Reactivity | Human |
Buffer | Water |
Stabilizer/Carrier | BSA (50-fold) |
Reconstitution | The lyophilized VEGF-C is soluble in water and most aqueous buffers. The lyophilized VEGF-C should be reconstituted in PBS or medium to a concentration not lower than 50 µg/ml. |
Stability and Storage | Lyophilized samples are stable for more than six months at -20°C to -70°C. Reconstituted VEGF-C should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles. |
Synonyms | vascular endothelial growth factor C; VEGFC; VRP; Flt4-L; VEGF c |
Description | VEGF-C, also known as Vascular Endothelial Growth Factor Related Protein (VRP), is a recently discovered VEGF growth factor family member that is most closely related to VEGF-D. The human VEGF-C cDNA encodes a pre-pro-protein of 416 amino acids residues. It is almost identical to the mouse VEGF-C protein. Similar to VEGF-D, VEGF-C has a VEGF homology domain spanning the middle third of the precursor molecule and long N- and C-terminal extensions. In adults, VEGF-C is highly expressed in heart, placenta, ovary and small intestine. Recombinant human VEGF-C, lacking the N- and C-terminal extensions and containing only the middle VEGF homology domain, forms primarily non-covalently linked dimers. This protein is a ligand for both VEGFR-2/KDR and VEGFR-3/FLT-4. Since VEGFR-3 is strongly expressed in lymphatic endothelial cells, it has been postulated that VEGF-C is involved in the regulation of the growth and/or differentiation of lymphatic endothelium. Although recombinant human VEGF-C is also a mitogen for vascular endothelial cells, it is much less potent than VEGF-A. The recombinant human VEGF-C contains 121 amino acids residues and was fused to a His-tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions. |
Protein Sequence | DPTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLHHHHHH |
Uniprot ID | P49767 |
Protein RefSeq | NP_005420.1 |
mRNA RefSeq | NM_005429.2 |
Figures

Biological activity measured by its ability to induce VEGFR-3/FLT-4 receptor phosphorylation in PAEC cells expressing VEGFR-3/FLT-4.

VEGF-C Sandwich-ELISA using recombinant human VEGF-C as standard [Cat# 300-079]. Mouse anti-human VEGF-C #9/G10 (Cat# 101-M88) was used as capture antibody, Biotinylated mouse anti-human VEGF-C #107/A11 (Cat# 101-MBi89) was used for detection.
Reference
- Role of Autophagy in HIV-1 Matrix Protein p17-Driven Lymphangiogenesis. P. Mazzuca et al., J Virol. 2017 Aug 15; 91(16): e00801-17.
- The histone deacetylase inhibitor trichostatin a decreases lymphangiogenesis by inducing apoptosis and cell cycle arrest via p21-dependent pathways. I. Hrgovic et al., BMC Cancer. 2016; 16: 763.
- Isolation and Characterization of Human Lung Lymphatic Endothelial Cells. B. Lorusso et al., Biomed Res Int. 2015; 2015: 747864.
- Genetic Heterogeneity of Lymphangiogenesis in Different Mouse Strains. B. Regenfuß et al., Am J Pathol. 2010 Jul; 177(1): 501–510.
- Ephrin-B2 controls VEGF-induced angiogenesis and lymphangiogenesis. Y. Wang et al., Nature. 2010 May 27;465(7297):483-6.
- Alternatively spliced VEGF receptor-2 is an essential endogenous inhibitor of lymphatic vessels. J.C. Romulo et al., Nat Med. Author manuscript; Nat Med. 2009 Sep; 15(9):1023–1030.
- U94 of human herpesvirus 6 inhibits in vitro angiogenesis and lymphangiogenesis. A. Caruso et al., Proc Natl Acad Sci U S A. 2009 Dec 1; 106(48): 20446–20451.
All prices plus VAT + possible delivery charges