Human FABP5
Slide this table
Cat-Nr. | 400-024 |
Size | 25 µg |
Price | 199 € |
Source | E. coli |
Label | His-Tag |
Formulation | lyophilized |
Purity Confirmation | > 98% by SDS-PAGE & visualized by Coomassie stain |
Length [aa] | 143 |
Molecular Weight | 16.1 kDa |
N Terminal Sequence | ATVQQ |
Biological Activity | Data not available. |
Species Reactivity | Human |
Buffer | PBS |
Reconstitution | Centrifuge vial prior to opening. Human FABP5 should be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C. |
Stability and Storage | The lyophilized human FABP5, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted human FABP5 should be stored in working aliquots at -20°C. |
Synonyms | Epidermal-type fatty acid-binding protein, E-FABP, Fatty acid-binding protein 5, Psoriasis-associated fatty acid-binding protein homolog, PA-FABP |
Description | Human FABP5, also known as epidermal fatty acid binding protein (E-FABP), is a 15 kDa member of a cytosolic fatty acid binding protein superfamily. It is associated with keratinocytes and adipocytes and is suggested to promote fatty acid availability to enzymes, protect cell structures from fatty acid attack, and target fatty acids to nuclear transcription factors. The amino acid sequence of human FABP5 is 80%, 81% and 92% identical to that of mouse, rat and bovine FABP5, respectively. |
Protein Sequence | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVETRHHHHHH |
Uniprot ID | Q01469 |
Protein RefSeq | NP_001435 |
mRNA RefSeq | NM_001444 |
Figures
![](/fileadmin/user_upload/products/FABP/400-024_Coom.jpg)
SDS-PAGE analysis of recombinant human FABP5. Sample was loaded in 15% SDS-polyacrylamide gel under reducing condition and stained with Coomassie blue.
All prices plus VAT + possible delivery charges