Human LIF
Slide this table
Cat-Nr. | 200-007 |
Size | 10 µg |
Price | 130 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 98% by SDS-PAGE |
Length [aa] | 180 |
Molecular Weight | 19.7 kDa |
N Terminal Sequence | SPLPIT |
Endotoxin Levels | < 0.1 ng per µg (Ieu/µg) of rh LIF |
Biological Activity | The ED50 as determined by the M1 cell differentiation assay is in the range of 0.1 - 0.5 ng/ml. |
Species Reactivity | Human |
Buffer | 50mM acetic acid |
Reconstitution | The lyophilized LIF should be reconstituted in water to a concentration not less than 100µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use. |
Stability and Storage | Lyophilized Leukemia Inhibitory Factor (LIF) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Leukemia Inhibitory Factor (LIF) should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles. |
Synonyms | LIF; CDF; DIA; HILDA; MLPLI |
Description | Leukemia Inhibitory Factor also called LIF is a lymphoid factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. Leukemia Inhibitory Factor has several functions such as cholinergic neuron differentiation, control of stem cell pluripotency, bone & fat metabolism, mitogenesis of factor dependent cell lines & promotion of megakaryocyte production in vivo. Human and mouse LIF exhibit a 78% identity in its amino acid sequence. Human LIF is as active on human cells as is it is on mouse cells, though mouse LIF is about 1000 fold less active on human cells, than human LIF. Recombinant human LIF produced in E. coli is a single, non-glycosylated, polypeptide chain containing 180 amino acids and having a molecular mass of 19.7 kDa. |
Protein Sequence | SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF |
Uniprot ID | P15018 |
Protein RefSeq | NP_002300.1 |
mRNA RefSeq | NM_002309.4 |
Figures
All prices plus VAT + possible delivery charges