Rat VEGF-C
Slide this table
Cat-Nr. | R20-015 |
Size | 20 µg |
Price | 220 € |
Source | Insect cells |
Formulation | lyophilized |
Purity Confirmation | > 90% by SDS-PAGE |
Length [aa] | 127 |
Molecular Weight | 15.0 - 20.0 kDa |
N Terminal Sequence | SIDNEWRKTQ AND NEWRKTQCMP |
Biological Activity | The biological activity was determined (i) by the ability to induce VEGFR-3/FLT-4 receptor phosphorylation in PAEC/VEGFR-3 cells and (ii) the VEGF-C-induced proliferation of primary human dermal lymphatic endothelial cells (HDLEC). |
Species Reactivity | Rat |
Buffer | 50 mM acetic acid |
Stabilizer/Carrier | BSA (50-fold) |
Reconstitution | The lyophilized VEGF-C is soluble in water and most aqueous buffers. The lyophilized VEGF-C should be reconstituted in PBS or medium to a concentration not lower than 50 µg/ml. |
Stability and Storage | Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted VEGF-C should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles! |
Synonyms | vascular endothelial growth factor C; Vegfc |
Description | VEGF-C, also known as Vascular Endothelial Growth Factor Related Protein (VRP), is a recently discovered VEGF growth factor family member that is most closely related to VEGF-D. The rat VEGF C cDNA encodes a pre-pro-protein of 416 amino acids residues. It is almost identical to the mouse VEGF-C protein. Similar to VEGF-D, VEGF-C has a VEGF homology domain spanning the middle third of the precursor molecule and long N- and C-terminal extensions. In adults, VEGF-C is highly expressed in heart, placenta, ovary and small intestine. Recombinant rat VEGF-C, lacking the N- and C-terminal extensions and containing only the middle VEGF homology domain, forms primarily non-covalently linked dimers. This protein is a ligand for both VEGFR-2/KDR and VEGFR-3/FLT-4. Since VEGFR-3 is strongly expressed in lymphatic endothelial cells, it has been postulated that VEGF-C is involved in the regulation of the growth and/or differentiation of lymphatic endothelium. Although recombinant rat VEGF-C is also a mitogen for vascular endothelial cells, it is much less potent than VEGF-A. The recombinant rat VEGF-C contains 127 amino acids residues and was fused to a His-tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 15-20 kDa protein in SDS-PAGE under reducing conditions. |
Protein Sequence | DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIHHHHHH |
Uniprot ID | O35757 |
Protein RefSeq | NP_446105.1 |
mRNA RefSeq | NM_053653.1 |
Figures

SDS-PAGE analysis of recombinant rat VEGF-C. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and visualized with Silver stain.

VEGF-C-induced proliferation of primary human dermal lymphatic endothelial cells (HDLEC). HDLECs were stimulated with increasing amounts of recombinant rat VEGF-C.
Reference
- Atypical cadherin FAT4 orchestrates lymphatic endothelial cell polarity in response to flow. K. L. Betterman et al., J Clin Invest. 2020 Jun 1; 130(6): 3315–3328.
- Vascular Endothelial Growth Factor Receptor 3 Controls Neural Stem Cell Activation in Mice and Humans. J. Han et al., Cell Rep. 2015 Feb 24; 10(7): 1158–1172.
- VEGF-C improves regeneration and lymphatic reconnection of transplanted autologous lymph node fragments: An animal model for secondary lymphedema treatment. L. Schindewolffs et al., Immun Inflamm Dis. 2014 Nov; 2(3): 152–161.
- The Indolinone MAZ51 Induces Cell Rounding and G2/M Cell Cycle Arrest in Glioma Cells without the Inhibition of VEGFR-3 Phosphorylation: Involvement of the RhoA and Akt/GSK3β Signaling Pathways. Joo-Hee Park et al., PLoS One. 2014; 9(9): e109055.
- A Global Transcriptome Analysis Reveals Molecular Hallmarks of Neural Stem Cell Death, Survival, and Differentiation in Response to Partial FGF-2 and EGF Deprivation. V. Nieto-Estévez et al., PLoS One. 2013; 8(1): e53594.
- Vascular endothelial growth factor receptor 3 directly regulates murine neurogenesis. C.-F. Calvo et al., Genes Dev. 2011 Apr 15; 25(8): 831–844.
- Effects of VEGFR-3 phosphorylation inhibitor on lymph node metastasis in an orthotopic diffuse-type gastric carcinoma model. M. Yashiro et al., Br J Cancer. 2009 Oct 6; 101(7): 1100–1106.
- VEGF-C is a trophic factor for neural progenitors in the vertebrate embryonic brain. B. Le Bras et al., Nat Neurosci. 2006 Mar;9(3):340-8.
All prices plus VAT + possible delivery charges