Human IP-10 (CXCL10)
Slide this table
Cat-Nr. | 100-057S |
Size | 5 µg |
Price | 90 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 98% by SDS-PAGE & HPLC analyses |
Length [aa] | 77 |
Molecular Weight | 8.6 kDa |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | Determined by its ability to chemoattract human T-Lymphocytes using a concentration of 10-50 ng/ml. |
Species Reactivity | Monkey, Mouse, Leech, Human |
Synonyms | CXCL10 |
Description | IP-10 is a CXC chemokine that signals through the CXCR3 receptor. IP-10 selectively chemoattracts Th1 lymphocytes and monocytes, and inhibits cytokine-stimulated hematopoietic progenitor cell proliferation. Additionally, it is angiostatic and mitogenic for vascular smooth muscle cells. Recombinant human IP-10 is an 8.6 kDa protein consisting of 77 amino acids including the four conserved cysteine residues present in CXC chemokines. |
Protein Sequence | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
Uniprot ID | P02778 |
Protein RefSeq | NP_001556.2 |
mRNA RefSeq | NM_001565.3 |
All prices plus VAT + possible delivery charges