Mouse TPO
Slide this table
Cat-Nr. | M10-087S |
Size | 2 µg |
Price | 90 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 98% by SDS-PAGE & HPLC analyses |
Length [aa] | 174 |
Molecular Weight | 18.7 kDa |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | The ED50 as determined by the dose-dependent stimulation of the proliferation of human MO7e cells was found to be < 1.0 ng/ml, corresponding to a specific activity of > 1 x 106 units/mg. |
Species Reactivity | Human, Mouse |
Synonyms | TPO, Thrombopoietin, MGDF, Megakaryocyte colony-stimulating factor, c-MPL Ligand |
Description | TPO is a lineage specific growth factor, produced in the liver, kidney and skeletal muscle. It stimulates the proliferation and maturation of megakaryocytes, and promotes increased circulating levels of platelets in vivo. TPO signals through the c-mpl receptor and acts as an important regulator of circulating platelets. Human and murine TPO exhibits cross-species reactivity. Recombinant murine TPO is a fully biologically active 174 amino acid polypeptide (18.7 kDa), which contains the erythropoietin-like domain of the full length TPO protein. |
Protein Sequence | SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKF |
Uniprot ID | P40226 |
Protein RefSeq | NP_033405.1 |
mRNA RefSeq | NM_009379.3 |
All prices plus VAT + possible delivery charges