Human VE-Statin/EGFL7
Slide this table
Cat-Nr. | 300-100 |
Size | 20 µg |
Price | 120 € |
Source | Insect cells |
Label | His-Tag |
Formulation | lyophilized |
Purity Confirmation | > 95% by SDS-PAGE |
Length [aa] | 211 |
Molecular Weight | 22.75 kDa |
Biological Activity | Testing under progress. |
Species Reactivity | Human |
Buffer | PBS |
Reconstitution | The lyophilized human EGFL7 should be reconstituted in water to a concentration of not lower than 50µg/ml. |
Stability and Storage | Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted EGFL7 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles! |
Synonyms | EGFL7; NEU1; ZNEU1; VE-STATIN; RP11-251M1.2, NOTCH4-like protein |
Description | EGFL7 (VE-Statin) is an ∼ 30 kDa secreted protein that contains an Emilin-like (EMI) domain (a multimerization motif), and two epidermal growth factor (EGF) domains, one of which binds calcium. Based on these domains, it has been hypothesized that EGFL7 may self-assemble like extracellular matrix (ECM) proteins and, thus, could incorporate into ECM. EGFL7 has been reported to stimulate cell adhesion as well as motility in a manner similar to ECM proteins. EGFL7 has been shown to be primarily expressed by developing ECs but also by primordial germ cells and some central nervous system neurons. Interestingly, EGFL7 expression markedly decreases in ECs in postnatal life, but can be strongly up-regulated after various tissue injuries that lead to increased angiogenic responses. |
Protein Sequence | HHHHHHTEHAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS |
Uniprot ID | Q9UHF1 |
Protein RefSeq | NP_057299.1 |
mRNA RefSeq | NM_016215.4 |
Figures
![](/fileadmin/user_upload/products/VEStatin_EGFL/300-100_Coom.jpg)
SDS-PAGE analysis of recombinant human EGFL7 derived from insect cells. Sample was loaded in 15% SDS-polyacrylamide gel under reducing condition and stained with Coomassie blue.
All prices plus VAT + possible delivery charges