Rabbit Growth Hormone
Slide this table
Cat-Nr. | 500-015 |
Size | 50 µg |
Price | 295 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 191 |
Molecular Weight | 21.5 kDa |
N Terminal Sequence | AFPAM |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg)< 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | rbGH is fully biologically active as evidenced by inducing proliferation of FDC-P1 cells stably transfected with rabbit GH receptor. |
Reconstitution | It is recommended to reconstitute the lyophilized rbGH in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
Description | Recombinant rabbit growth hormone (rbGH), one polypeptide chain containing 190 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 21.5 kDa |
Protein Sequence | AAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDMELLRFSLLLIQSWLGPVQFLSRAFTNTLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRVGQLLKQTYDKFDTNLRGDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCVF |
Uniprot ID | P46407 |
Protein RefSeq | NP_001316004.1 |
mRNA RefSeq | NM_001329075.1 |
All prices plus VAT + possible delivery charges