Human CCM-3
Slide this table
| Cat-Nr. | 300-056 |
| Size | 20 µg |
| Price | 120 € |
| Source | E. coli |
| Label | His-Tag |
| Formulation | lyophilized |
| Purity Confirmation | > 95% by SDS-PAGE |
| Length [aa] | 231 |
| Molecular Weight | 26.7 kDa |
| Biological Activity | Data not available. |
| Species Reactivity | Human |
| Buffer | PBS |
| Reconstitution | The lyophilized CCM3 is soluble in water and most aqueous buffers and should be reconstituted in water or PBS. |
| Stability and Storage | Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted CCM-3 should be stored in working aliquots at -20°C. |
| Synonyms | PDCD10; CCM3; TFAR15; programmed cell death 10 |
| Description | Cerebral cavernous malformations (CCMs) are sporadically acquired or inherited vascular lesions of the central nervous system consisting of clusters of dilated thin-walled blood vessels that predispose individuals to seizures and stroke. Mutations in CCM1, CCM2, or CCM3 lead to cerebral cavernous malformations, one of the most common hereditary vascular diseases of the brain. Endothelial cells within these lesions are the main disease compartments. Here, we show that adenoviral CCM3 expression inhibits endothelial cell migration, proliferation, and tube formation while down regulation of endogenous CCM3 results in increased formation of tube-like structures. Adenoviral CCM3 expression does not induce apoptosis under normal endothelial cell culture conditions but protects endothelial cells from staurosporine-induced cell death. Tyrosine kinase activity profiling suggests that CCM3 supports PDPK-1/Akt-mediated endothelial cell quiescence and survival (Schleider et al, Neurogenetics 12, 2011). The CCM-3 is fused to a N-terminal His-tag (6x His). |
| Protein Sequence | MGSSHHHHHHSSGLVPRGSMRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA |
| Uniprot ID | Q9BUL8 |
| Protein RefSeq | NP_009148 |
| mRNA RefSeq | NM_007217 |
Figures
SDS-PAGE analysis of recombinant human CCM3. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and visualized with Silver staining.
All prices plus VAT + possible delivery charges