Human AITRL
Slide this table
| Cat-Nr. | 100-122S |
| Size | 5 µg |
| Price | 95 € |
| Source | E. coli |
| Formulation | lyophilized |
| Purity Confirmation | > 97% by SDS-PAGE & HPLC analyses |
| Length [aa] | 126 |
| Molecular Weight | 14.3 kDa |
| Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
| Biological Activity | Determined by its ability to stimulate IL-8 production by human PBMC using a concentration range of 1.0-10.0 ng/ml. Please Note: Results may vary with PBMC donors. |
| Species Reactivity | Human |
| Synonyms | TNFSF18; TL6; AITRL; GITRL; hGITRL |
| Description | AITRL, a member of the TNF superfamily, is expressed in endothelial cells, and signals through the AITR receptor. AITRL regulates T-cell proliferation and survival, and effectuates the interaction between T lymphocytes and endothelial cells. The AITRL gene codes for a type II transmembrane protein comprised of 177 amino acids, including a 28 amino acid cytoplasmic region, a 21 amino acid transmembrane domain and a 128 amino acid extracellular domain. Recombinant human soluble AITRL is a 14.3 kDa protein, containing 126 amino acid residues corresponding to the extracellular domain of AITRL. |
| Protein Sequence | ETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFI |
| Uniprot ID | Q9UNG2 |
| Protein RefSeq | NP_005083.2 |
| mRNA RefSeq | NM_005092.3 |
All prices plus VAT + possible delivery charges