Mouse GM-CSF
Slide this table
| Cat-Nr. | M30-012S |
| Size | 2 µg |
| Price | 65 € |
| Source | E. coli |
| Formulation | lyophilized |
| Purity Confirmation | > 98% by SDS-PAGE |
| Length [aa] | 125 |
| Molecular Weight | 14.2 kDa |
| N Terminal Sequence | MAPTRSPITV |
| Endotoxin Levels | < 0.1 ng per µg of GM-CSF |
| Biological Activity | Testing in Progress. |
| Species Reactivity | Mouse |
| Buffer | 30 mM Tris pH8 |
| Reconstitution | The lyophilized mouse GM-CSF is soluble in water and most aqueous buffers. It can be reconstituted in water to a concentration of 100 µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use. For most in vitro applications, mouse GM-CSF exerts its biological activity in the concentration range of 0.05 to 0.5ng/ml. |
| Stability and Storage | The lyophilized mouse GM-CSF, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted mouse GM-CSF should be stored in working aliquots at -20°C. |
| Synonyms | Csf2; Csfgm; GMCSF; Gm-CSf; MGI-IGM |
| Description | GM-CSF is a hematopoietic growth factor that stimulates the development of neutrophils and macrophages and promotes the proliferation and development of early erythroid megakaryocytic and eosinophilic progenitor cells. It is produced in endothelial cells, monocytes, fibroblasts and T-lymphocytes. GM-CSF inhibits neutrophil migration and enhances the functional activity of the mature end-cells. The human and murine molecules are species-specific and exhibit no cross-species reactivity. Recombinant murine GM-CSF is a 14.2 kDa globular protein consisting of 124 amino acids residues. |
| Protein Sequence | MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK |
| Uniprot ID | P01587 |
| Protein RefSeq | NP_034099.2 |
| mRNA RefSeq | NM_009969.4 |
Figures
SDS-PAGE analysis of recombinant mouse GM-CSF. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and stained with Coomassie blue.
Reference
- Restoring microenvironmental redox and pH homeostasis inhibits neoplastic cell growth and migration: therapeutic efficacy of esomeprazole plus sulfasalazine on 3-MCA-induced sarcoma. E. Balza et al., Oncotarget. 2017 Jun 27;8(40):67482-67496.
- β2-adrenergic agonists bias TLR-2 and NOD2 activated dendritic cells towards inducing an IL-17 immune response. M. Manni et al., Cytokine. 2011 Sep; 55-3: 380–386.
All prices plus VAT + possible delivery charges