Ovine Leptin pegylated super antagonist (mutant D23L/L39A/D40A/F41A)
Slide this table
Cat-Nr. | 500-069S |
Size | 50 µg |
Price | 295 € |
Source | E. coli |
Label | PEG |
Formulation | lyophilized |
Purity Confirmation | > 95.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 146 |
Molecular Weight | 35.6 kDa |
N Terminal Sequence | AVPIR |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | Pegylated recombinant super active ovine leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. The in vitro activity of pegylated recombinant super active ovine leptin antagonist is 6-8 fold lower than the non-pegylated antagonist but is 15 fold higher as compared to pegylated recombinant super active ovine leptin antagonist |
Species Reactivity | Ovine |
Reconstitution | It is recommended to reconstitute the lyophilized pegylated recombinant super active ovine leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
Synonyms | Lep; ob; obese |
Description | Mono-pegylated (with 20 kDa PEG) recombinant super active ovine leptin antagonist is one polypeptide chain containing 146 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 35.6 kDa as determined by MS. However due to enlarged hydrodymanic volume pegylated recombinant super active ovine leptin antagonist runs on the SGS-Page as 48 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. The half-life in circulation of pegylated recombinant super active ovine leptin antagonist after SC injection was over 20 hours. Recombinant super active ovine leptin antagonist was initially mutated, resulting in D23L/L39A/D40A/F41A mutant that was purified by proprietary chromatographic techniques. The pegylation of recombinant super active ovine leptin antagonist is similar to that described in Elinav et al. Endocrinology 150:3083-91 (2009) for pegylated recombinant super active mouse leptin antagonist |
Protein Sequence | AVPIRKVQDDTKTLIKTIVTRINLISHTQSVSSKQRVTGAAAAPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG |
Protein RefSeq | XP_027824581.2 |
mRNA RefSeq | XM_027968780.2 |
All prices plus VAT + possible delivery charges