Human PDGF-BB
Slide this table
Cat-Nr. | 200-056 |
Size | 20 µg |
Price | 175 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 95% by SDS-PAGE |
Length [aa] | 109 |
Molecular Weight | 24.3 kDa |
Endotoxin Levels | < 0.1 ng per ug of PDGF-BB |
Biological Activity | The biological activity was determined by the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts). |
Species Reactivity | Human |
Buffer | 50mM acetic acid |
Reconstitution | Centrifuge vial prior to opening. The lyophilized PDGF-BB should be reconstituted in 50mM acetic acid to a concentration not lower than 100μg/ml. For long term storage of reconstituted protein addition of carrier protein (e.g. BSA or HSA; 0.1%) is recommended. |
Stability and Storage | The lyophilized PDGF-BB is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted PDGF-BB is best stored at -20°C to -70°C. |
Synonyms | PDGF-2; Platelet-derived growth factor B chain; Platelet-derived growth factor beta polypeptide; Proto-oncogene c-Sis; INN=Becaplermin |
Description | PDGFs are disulfide-linked dimers consisting of two 12.0-13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs; PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. The PDGFs are stored in platelet alpha-granules and are released upon platelet activation. The PDGFs are involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. Two distinct signaling receptors used by PDGFs have been identified and named PDGFR-alpha and PDGFR-beta. PDGFR-alpha is high-affinity receptor for each of the three PDGF forms. On the other hand, PDGFR-beta interacts with only PDGF-BB and PDGF-AB. Recombinant human PDGF-BB is a 24.3 kDa disulfide-linked homodimer of two B chains (218 total amino acids). |
Protein Sequence | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
Uniprot ID | P01127 |
Protein RefSeq | NP_002599.1 |
mRNA RefSeq | NM_002608.2 |
Figures

SDS-PAGE analysis of recombinant human PDGF-BB. Sample was loaded in 15% SDS-polyacrylamide gel under non-reducing condition and stained with Coomassie Blue.

Proliferation assay with NHDF cells. The cells were stimulated using recombinant human PDGF-BB and the WHO standard 74/728. Values are the means (±SD) of triplicate determinations and expressed as percentage of control.
Reference
- Therapeutic Potential of Anti-Angiogenic Multitarget N,O-Sulfated E. Coli K5 Polysaccharide in Diabetic Retinopathy. Rezzola S. et al., Diabetes. 2015 Jul;64(7):2581-92.
All prices plus VAT + possible delivery charges