Mouse PlGF
Slide this table
Cat-Nr. | M30-019S |
Size | 2 µg |
Price | 85 € |
Source | Insect cells |
Formulation | lyophilized |
Purity Confirmation | > 95% by SDS-PAGE |
Length [aa] | 135/132 |
Molecular Weight | ~40 kDa |
N Terminal Sequence | ALSAGNNSTE and AGNNSTE |
Biological Activity | Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant mouse PlGF can bind to immobilized rh-sFlt-1 (100 ng/well) with a linear range at 0.5 - 10 ng/mL. |
Species Reactivity | Mouse |
Buffer | 25 mM Tris, 75 mM NaCl pH 8.5 |
Stabilizer/Carrier | BSA (50-fold) |
Reconstitution | Centrifuge vial prior to opening. The lyophilised PlGF is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM acetic acid or PBS/water. This solution can be diluted into other buffered solutions or stored frozen for future use. |
Stability and Storage | The lyophilized mouse PIGF, though stable at room temperature, is best stored in working aliquots at -20°C to -70°C. |
Synonyms | Pgf; PlGF; Plgf; AI854365; placental growth factor |
Description | Placenta growth factor (PlGF) is a member of the vascular endothelial growth factor (VEGF) family of growth factors. PlGF and VEGF share primary structural as well as limited amino acid sequence homology with the A and B chains of PDGF. All eight cysteine residues involved in intra and interchain disulfides are conserved among these growth factors. As a result of alternative splicing, three PlGF RNAs encoding monomeric human PlGF-1, PlGF-2 and PlGF-3 isoform precursors containing 149, 179 and 219 amino acid residues, respectively, have been described. In normal mouse tissues, only one mouse PlGF mRNA encoding the equivalent of human PlGF-2 has been identified. Mouse PlGF shares 65% amino acid identity with human PlGF-2. The gene for PlGF has been mapped to mouse chromosome 12 and human chromosome 14. PlGF binds with high affinity to Flt1, but not to Flk1/KDR. |
Protein Sequence | ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP |
Uniprot ID | P49764 |
Protein RefSeq | NP_032853 |
mRNA RefSeq | NM_008827 |
Figures

SDS-PAGE analysis of recombinant mouse PlGF. Samples were loaded in 15% SDS-polyacrylamide gel under non-reducing conditions and stained with Coomassie blue. Lane 1: MWM (kDa); lane 2/3: 2ug of recombinant mouse PlGF.

Functional ELISA for recombinant mouse PlGF produced in insect cells. A 96-well ELISA plate was coated with rmPlGF [100µl/well; 0,5µg/ml]. Increasing concentrations of recombinant human soluble sFlt-1 were added. Detection was performed using a biotinylated monoclonal anti-human VEGFR-1 antibody. As a control recombinant sKDR was used. There was no binding signal detectable.
Reference
- The Anti-Vascular Endothelial Growth Factor Receptor 1 (VEGFR-1) D16F7 Monoclonal Antibody Inhibits Melanoma Adhesion to Soluble VEGFR-1 and Tissue Invasion in Response to Placenta Growth Factor. M. G. Atzori et al., Cancers (Basel). 2022 Nov; 14(22): 5578.
All prices plus VAT + possible delivery charges