Dog Leptin
Slide this table
| Cat-Nr. | 500-060S |
| Size | 100 µg |
| Price | 210 € |
| Source | E. coli |
| Formulation | lyophilized |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 146 |
| Molecular Weight | 16.0 kDa |
| N Terminal Sequence | AVPIR |
| Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
| Biological Activity | Recombinant dog leptin is fully biologically active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. |
| Species Reactivity | Dog |
| Reconstitution | It is recommended to reconstitute the lyophilized recombinant dog leptin in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Synonyms | Lep; ob; obese |
| Description | Recombinant dog leptin is an one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. Dog leptin was purified by proprietary chromatographic techniques, (Solomon, Charlier, Djiane and Gertler, unpublished results). |
| Protein Sequence | AVPIRKVQDDTKTLIKTIVARINDISHTQSVSSKQRVAGLDFIPGLQPVLSLSRMDQTLAIYQQILNSLHSRNVVQISNDLENLRDLLHLLASSKSCPLPRARGLETFESLGGVLEASLYSTEVVALNRLQAALQDMLRRLDLSPGC |
| Uniprot ID | O02720 |
| Protein RefSeq | NP_001003070.1 |
| mRNA RefSeq | NM_001003070.1 |
All prices plus VAT + possible delivery charges