Human IL-22 receptor antagonist (Y51A) , pegylated
Slide this table
Cat-Nr. | 500-028S |
Size | 10 µg |
Price | 310 € |
Source | E. coli |
Label | PEG |
Formulation | lyophilized |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 147 |
Molecular Weight | 36.0 kDa (monomer) |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg)< 0.1 ng/µg of protein (<1EU/µg)< 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | Recombiant human IL-22 Y51A mutant is biologically active, capable of full inhibition of mouse IL-22 induced STAT3 phosphorylation in HepG cells. Its inhibitory acrtivity in vitro is ~ 10-20% compared to the non-pegylated mIL22 (Y51A) mutant. |
Species Reactivity | Human |
Reconstitution | It is recommended to reconstitute the lyophilized pegylated mouse IL22 Y51A in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
Synonyms | I-TIF |
Description | Mono-pegylated (with 20 kDa PEG)recombinant human interleukin 22 Y51A mutant (numbering according to human IL-22 including signal peptide) is one polypeptide chain containing 147 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 36 kDa as determined by MS. However due to enlarged hydrodymanic volume it runs on the SGS-Page as 50 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. It was prepared similarly to that described by L. Niv-Spector et al. Protein Eng Des Sel. (PEDS) 25:397-404 (2012). |
Protein Sequence | AAPISSHCRLDKSNFQQPAITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
Uniprot ID | Q9GZX6 |
Protein RefSeq | NP_065386.1 |
mRNA RefSeq | NM_020525.4 |
All prices plus VAT + possible delivery charges