Orf virus VEGF-E
Slide this table
Cat-Nr. | 300-044S |
Size | 2 µg |
Price | 90 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 90% by SDS-PAGE |
Length [aa] | 132 |
Molecular Weight | 35 kDa (Dimer) |
Endotoxin Levels | < 0.1 ng per µg of ov-VEGF-E |
Biological Activity | Measured in a cell proliferation assay using primary HUVECs. The ED50 for this effect is typically 1 – 5 ng/mL. |
Species Reactivity | Orf Virus |
Buffer | PBS |
Reconstitution | The lyophilized ovVEGF-E should be reconstituted in water or medium to a concentration not lower than 50 µg/ml. For long term storage we would recommend to add at least 0.1% human or bovine serum albumin. |
Synonyms | Vascular Endothelial Growth Factor-E |
Description | A DNA sequence encoding the mature variant of ovVEGF-E isolate D1701 (Dehio et al., 1999; GenBank accession No. AF106020) was expressed in E. coli as a 132 amino acid residue fusion protein with an N-terminal His-tag sequence and a thrombin cleavage site. Recombinant VEGF-E homodimer was dimerized in vitro and has a predicted mass of approximately 35 kDa. Based on sequence similarity to VEGF-A, a gene encoding a VEGF homologue has recently been discovered in the genome of Orf virus (OV) (Lyttle et al., 1994). Different isolates of Orf virus show significant amino acid sequence similarity to VEGF-A and described as a viral virulence factor that appears to be derived from captured host genes. All eight cysteine residues of the central cysteine knot motif characteristic of members of the VEGF family are conserved among other residues in the VEGF-E proteins (Dehio et al., 1999; Wise et al., 1999). Alignment of all mammalian VEGF sequences indicated that VEGF-E is distinct from the previously described VEGFs but most closely related to VEGF-A. Like VEGF-A, VEGF-E was found to bind with high affinity to VEGF receptor-2 (KDR) resulting in receptor autophosphorylation, whilst in contrast to VEGF-A, VEGF-E can not bind to VEGF receptor-1 (Flt-1). Furthermore VEGF-E can also not bind to VEGF receptor-3 (FLT-4). Therefore VEGF-E is a potent angiogenic factor selectively binding to VEGF receptor –2/KDR. |
Protein Sequence | MGSSHHHHHHSSGLVPRGSHDSTKTWSEVFENSGCKPRPMVFRVHDEHPELTSQRFNPPCVTLMRCGGCCNDESLECVPTEEANVTMQLMGASVSGGNGMQHLSFVEHKKCDCKPPLTTTPPTTTRPPRRRR |
Uniprot ID | Q9YMF3 |
Protein RefSeq | AAD03735.1 |
mRNA RefSeq | AF106020.1 |
Figures
![](/fileadmin/user_upload/products/VEGF/300-044_Coom.jpg)
SDS-PAGE analysis of recombinant ov-VEGF-E. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and stained with Coomassie blue.
![](/fileadmin/user_upload/products/VEGF/300-044_WB.jpg)
Confluent PAE/KDR cells were stimulated with 50ng/ml human VEGF165 (#300-036), human VEGF-C (#300-079), rat VEGF-C (#R20-015), Orf virus VEGF-E (#300-045) and snake venom VEGF-F (#300-097) for 10 min at 37°C. The IP was performed using an anti-human KDR antibody (#101-M32), WB with an anti-human KDR antibody (#101-M34) and an anti-Phosphotyrosine antibody.
Reference
- Paracrine Signals From Liver Sinusoidal Endothelium Regulate Hepatitis C Virus Replication. I. A. Rowe et al., Hepatology. 2014 Feb; 59(2): 375–384.
- Autocrine activity of soluble Flt-1 controls endothelial cell function and angiogenesis. S. Ahmad et al., Vasc Cell. 2011; 3: 15.
- Hepatitis C virus infection reduces hepatocellular polarity in a vascular endothelial growth factor dependent manner. C. J. Mee et al., Gastroenterology. 2010 Mar; 138(3): 1134–1142.
- The VEGF-induced transcriptional response comprises gene clusters at the crossroad of angiogenesis and inflammation. B. Schweighofer et al., Thromb Haemost. 2009 Sep; 102(3): 544–554.
All prices plus VAT + possible delivery charges