Mouse Leptin super antagonist (mutant D23L/L39A/D40A/F41A)
Slide this table
Cat-Nr. | 500-050 |
Size | 100 µg |
Price | 295 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 146 |
Molecular Weight | 16.0 kDa |
N Terminal Sequence | AVPIQ |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg)< 0.1 ng/µg of protein (<1EU/µg)< 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | Recombinant mouse super-active leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. Mouse super-active leptin antagonist also inhibits various leptin effects in several in vitro bioassays. The inhibitory activity of mouse super-active leptin antagonist was increased 14 to 60 fold as measured by various criteria such as binding properties to human leptin binding domain (hLBD) and in vitro and in vivo bioassays as compared to mouse leptin antagonist . |
Species Reactivity | Mouse |
Reconstitution | It is recommended to reconstitute the lyophilized mouse super-active leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
Synonyms | Lep; ob; obese |
Description | Recombinant mouse leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa, mLEP was mutated, resulting in D23L/L39A/D40A/F41A mutant that was purified by proprietary chromatographic techniques. |
Protein Sequence | AVPIQKVQDDTKTLIKTIVTRINLISHTQSVSAKQRVTGAAAIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC |
Uniprot ID | P41160 |
Protein RefSeq | NP_032519.1 |
mRNA RefSeq | NM_008493.3 |
All prices plus VAT + possible delivery charges