Chicken Leptin
Slide this table
| Cat-Nr. | 500-058 |
| Size | 500 µg |
| Price | 510 € |
| Source | E. coli |
| Formulation | lyophilized |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 146 |
| Molecular Weight | 16.0 kDa |
| N Terminal Sequence | AVPCQ |
| Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
| Biological Activity | Recombinant chicken leptin is biologically active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. Its activity is however 5-10 fold lower as compared to mammalian leptins. |
| Species Reactivity | Chicken |
| Reconstitution | It is recommended to reconstitute the lyophilized recombinant chicken leptin in sterile water or 0.4% NaHCO3 adjusted tp pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Synonyms | Lep; ob; obese |
| Description | Recombinant chicken leptin is an one polypeptide chain containing 145 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. Chicken leptin was prepared according to the sequence published by the groups of Taouis and McMutry, purified by proprietary chromatographic techniques, see Raver et al. Protein Expr Purif. 1998 Dec; 14(3):403-8. |
| Protein Sequence | AVPCQIFQDDTKTLIKTIVTRINDISHTSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDISPEC |
| Uniprot ID | O42164 |
| Protein RefSeq | APC23099.1 |
| mRNA RefSeq | KT970642.1 |
All prices plus VAT + possible delivery charges