Human VEGF-B167
Slide this table
Cat-Nr. | 300-080S |
Size | 5 µg |
Price | 70 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 98% by SDS-PAGE & Coomassie stain |
Length [aa] | 167 |
Molecular Weight | 38 kDa |
N Terminal Sequence | MPVSQ |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized human sVEGFR-1/Flt-1 at 1 µg/mL (100 µL/well) can bind rhVEGF-B167 with a linear range of 0.5 ng/mL to 12.5 ng/mL. |
Species Reactivity | Human |
Buffer | 50mM acetic acid |
Reconstitution | The lyophilized VEGF-B167 should be reconstituted in water to a concentration not lower than 50 µg/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin. |
Stability and Storage | Lyophilized samples are stable for greater than six months at –20°C to –70°C. Reconstituted VEGF-B167 should be stored in working aliquots at -20°C. |
Synonyms | vascular endothelial growth factor B; VEGFB; VRF; VEGFL |
Description | VEGF-B, a member of the VEGF family, is a potent growth and angiogenic cytokine. It promotes DNA synthesis in endothelial cells, helps regulate angiogenesis and vascular permeability, and inhibits apoptosis in certain smooth muscle cells and neurons. VEGF-B is expressed in all tissues except the liver. It forms cell surfaced-associated disulfide linked homodimers and can form heterodimers with VEGF-A. There are two known isoforms, formed by alternative splicing, which have been designated VEGF-B167 and VEGF-B186. Both forms have identical amino-terminal sequences encoding a “cysteine knot” like structural motif, but differ in their carboxyl-terminal domains. Both VEGF-B isoforms signal only through the VEGFR1 receptor. Recombinant human VEGF-B is a 38.0 kDa disulfide-linked homodimeric protein consisting of two 167 amino acid polypeptide chains. |
Protein Sequence | MPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDSPRPLCPRCTQHHQRPDPRTCRCRCRRRSFLRCQGRGLELNPDTCRCRKLRR |
Uniprot ID | P49765 |
Protein RefSeq | NP_003368.1 |
mRNA RefSeq | NM_003377.4 |
Figures

SDS-PAGE analysis of recombinant human VEGF-B167 produced in E. coli. Samples were loaded under reducing and non-reducing conditions in 15% SDS-polyacrylamide gel and stained with Coomassie Blue.

VEGF-B167 BioLISA using recombinant human soluble Flt-1 [Cat# S01-010] for capturing and recombinant human VEGF-B167 as standard. A mouse anti-human VEGF-B antibody in combination with a goat anti-mouse Biotin-conjugated antibody was used for detection.
All prices plus VAT + possible delivery charges