Mouse SF-20
Slide this table
Cat-Nr. | M10-092S |
Size | 2 µg |
Price | 75 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 98% by SDS-PAGE & HPLC analyses |
Length [aa] | 143 |
Molecular Weight | 15.8 kDa |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | Data not available. |
Species Reactivity | Mouse |
Synonyms | C19orf10; IL25; IL27; SF20; IL27w; R33729_1; EUROIMAGE1875335 |
Description | Mouse SF20 is a bone marrow stroma-derived growth factor. SF20 is expressed in the bone marrow, spleen stroma cells, resting mononuclear cells, resting CD8+ and CD19+ cells and activated CD8+ T cells. SF20 has been shown to bind to the surface of cells expressing the receptor TSA-1 (Thymic shared Ag-1). Among SF20’s biological activities is stimulation of the proliferation of FDCP2 cells (a mouse factor-dependent hemopoietic cell line) and mouse lymphoid cells. |
Protein Sequence | MVSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLKSEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL |
Uniprot ID | Q9CPT4 |
Protein RefSeq | NP_543027.1 |
mRNA RefSeq | NM_080837.2 |
All prices plus VAT + possible delivery charges