Ovine Leptin R4C mutant
Slide this table
Cat-Nr. | 500-064 |
Size | 500 µg |
Price | 510 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 146 |
Molecular Weight | 16.0 kDa |
N Terminal Sequence | ACPIC |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg)< 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | Recombinant ovine leptin R4C mutant is fully biologically active compared to the wild-type ovine leptin as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. |
Species Reactivity | Ovine |
Reconstitution | It is recommended to reconstitute the lyophilized recombinant ovine leptin R4C mutant in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Synonyms | Lep; ob; obese |
Description | Recombinant ovine leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. The wild type leptin was mutated at position 4 replacing arginine by cysteine. Recombinant ovine leptin R4C mutant was purified by proprietary chromatographic techniques, see Reicher et al. J. Animal Sciences 90:410-418 (2012). |
Protein Sequence | AVPCRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG |
Protein RefSeq | XP_027824581.2 |
mRNA RefSeq | XM_027968780.2 |
All prices plus VAT + possible delivery charges