Human PDGF-AA
Slide this table
Cat-Nr. | 200-051 |
Size | 5 µg |
Price | 80 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 95% by SDS-PAGE |
Length [aa] | 125 |
Molecular Weight | 28.5 kDa |
N Terminal Sequence | SIEEAVPA |
Endotoxin Levels | < 0.1 ng per ug of PDGF-AA |
Biological Activity | The biological activity was determined by the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts). |
Species Reactivity | Human |
Buffer | 50mM acetic acid |
Reconstitution | Centrifuge vial prior to opening. The lyophilized PDGF-AA should be reconstituted in water to a concentration not lower than 50 µg/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin. |
Stability and Storage | The lyophilized PDGF-AA is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted PDGF-AA is best stored at -20°C to -70°C. Avoid repeated freeze-thaw cycles. |
Synonyms | PDGFA; PDGF1; PDGF-A |
Description | PDGFs are disulfide-linked dimers consisting of two 12.0-13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs; PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. The PDGFs are stored in platelet alpha-granules and are released upon platelet activation. The PDGFs are involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. Two distinct signaling receptors used by PDGFs have been identified and named PDGFR-alpha and PDGFR-beta. PDGFR-alpha is high-affinity receptor for each of the three PDGF forms. On the other hand, PDGFR-beta interacts with only PDGF-BB and PDGF-AB. Recombinant human PDGF-AA is a 28.5 kDa disulfide-linked homodimer of two A chains (250 total amino acids). |
Protein Sequence | SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT |
Uniprot ID | P04085 |
Protein RefSeq | NP_002598.5 |
mRNA RefSeq | NM_002607.5 |
Figures

SDS-PAGE analysis of recombinant human PDGF-AA. Sample was loaded in 15% SDS-polyacrylamide gel under reducing condition and visualized with Silver stain.
All prices plus VAT + possible delivery charges