Human Nectin-2, soluble
Slide this table
Cat-Nr. | S01-076 |
Size | 25 µg |
Price | 170 € |
Source | E. coli |
Label | His-Tag |
Formulation | lyophilized |
Length [aa] | 338 |
Species Reactivity | Human |
Reconstitution | Human sNectin-2 should be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C. |
Stability and Storage | The lyophilized human sNectin-2, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted human sNectin-2 is stable for about 2 weeks at 4°C but for longer periods should be stored in working aliquots at -20°C. |
Synonyms | Herpes virus entry mediator B, Herpesvirus entry mediator B, HveB, Nectin cell adhesion molecule 2, Poliovirus receptor-related protein 2, CD112 |
Description | Nectins are a small family of Ca++independent immunoglobulin (Ig)-like cell adhesion molecules (CAMs) that organize intercellular junctions. The Nectin family has at least four members, all of which show alternate splicing (except for Nectin-4), a transmembrane (TM) region (except for Nectin-1 gamma), and three extracellular Ig-domains. Nectin-2 is a 60 or 65 kDa type I transmembrane (TM) glycoprotein that is found on a variety of cell types. It has two splice forms. Nectin-2 delta is a 65 kDa long form and is synthesized as a 538 amino acid precursor. It contains a 31 amino acid (aa) signal sequence, a 329 aa extracellular region, a 21 aa TM segment, and a 157 aa cytoplasmic domain. The extracellular region contains one N terminal 85 aa V-type Ig domain and two 45-55 aa C2-type Ig domains. The V-domain is believed to mediate Nectin binding to its ligands. The short, 60 kDa isoform of Nectin-2 (Nectin-2 alpha) has the same signal sequence and extracellular domain as Nectin-2 delta, but differs in the TM and cytoplasmic region. In this case, the cytoplasmic tail is only 94 aa in length. Nectin-2 is known to bind the pseudorabies virus, and herpes simplex virus2 (HSV2), but not HSV1. As a cell adhesion molecule, Nectin-2 will form cis-homodimers (same cell), followed by trans-dimers (across cells). Nectin-2 will not cis-dimerize with other Nectins, but will cis-dimerize with its two splice forms. Notably, a Nectin-2 cis-dimer on one cell will heterodimerize with a Nectin-3 cis-dimer on another cell. Nectin-2 is found concentrated in adherens junctions, and exists on neurons, endothelial cells, epithelial cells and fibroblasts. |
Protein Sequence | AQDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGGLEHHHHHH |
Uniprot ID | Q92692 |
Protein RefSeq | NP_001036189.1. |
mRNA RefSeq | NM_001042724.1. |
All prices plus VAT + possible delivery charges