Human IL-1 receptor antagonist, soluble
Slide this table
Cat-Nr. | S01-061 |
Size | 20 µg |
Price | 170 € |
Source | HEK 293 cells |
Formulation | lyophilized |
Purity Confirmation | > 98% by SDS-PAGE & HPLC analysis |
Length [aa] | 339 |
Molecular Weight | 37.2 kDa |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | The ED50 was determined by its ability to intensify the IL-6 induced growth inhibition of murine M1 cells is ≤ 5.0 ng/ml, in the presence of 20 ng/ml of rhIL-6. |
Species Reactivity | Mouse, Rat, Human |
Synonyms | soluble IL-6 receptor alpha, B cell stimulatory factor-2, CD126 |
Description | IL-6 mediates its biological effects through the type I IL-6 receptor system that consists of two chains, IL-6Rα and gp130. The IL-6Rα chain is the binding component specific to IL-6; while the gp130 only transmits signals of IL-6 when bound to IL-6Rα. The gp130 also can transmit signals from LIF, OSM, CNTF, IL-11 and CT-1 in conjunction with other receptor subunits. The low-affinity binding site for IL-6 is composed of IL-6Rα alone. IL-6Rα is expressed in a wide range of cells including T cells, fibroblasts and macrophages. Soluble IL-6Rα which consists of only the extracellular domain of the IL-6Rα chain, acts as an agonist of IL-6 activity at low concentrations. Recombinant human sIL-6Rα is a 37.6 kDa protein consisting of the extracellular domain of the IL-6Rα chain (339 amino acid residues). |
Protein Sequence | LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQD |
Uniprot ID | P08887 |
Protein RefSeq | NP_000556.1. |
mRNA RefSeq | NM_000565.3 |
All prices plus VAT + possible delivery charges