Human BMP receptor-1A, soluble
Slide this table
Cat-Nr. | S01-021 |
Size | 100 µg |
Price | 299 € |
Source | Insect cells |
Label | His-Tag |
Formulation | lyophilized |
Purity Confirmation | > 90% by SDS-PAGE |
Length [aa] | 135 |
Molecular Weight | 23 kDa |
Biological Activity | Measured by its ability to inhibit recombinant human BMP-2 induced alkaline phosphatase production by C2C12 myogenic cells. The ED50 for this effect is typically 1-5 µg/ml in the presence of 500 ng/ml of recombinant human BMP-2. |
Species Reactivity | Human |
Buffer | PBS |
Reconstitution | The lyophilized sBMPR-1A is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium to a concentration not lower than 50µg/ml. |
Stability and Storage | Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sBMPR-1A should be stored in working aliquots at -20°C. |
Synonyms | ALK3; SKR5; CD292; ACVRLK3; 10q23del; bone morphogenetic protein receptor, type IA |
Description | The extracellular domain of human BMPR-IA was fused with a carboxy-terminal 6X histidine-tag. The monomeric glycoprotein was expressed in baculovirus infected insect cells. Cellular responses to bone morphogenetic proteins (BMPs) have been shown to be mediated by the formation of hetero-oligomeric complexes of the type I and type II serine/threonine kinase receptors. BMP receptor 1A (BMPR-1A), also known as activin receptor-like kinase (ALK)-3, is a one of seven known type I serine/threonine kinases that are required for the signal transduction of TGF-b family cytokines. In contrast to the TGF-b receptor system in which the type I receptor does not bind TGF-b in the absence of the type II receptor, type I receptors involved in BMP signaling (including BMPR-IA, BMPR-IB/ALK-6, and ActR-I/ALK-2) can independently bind the various BMP family proteins in the absence of type II receptors. Recombinant soluble BMPR-IA binds BMP-2 and -4 with high-affinity in solution and is a potent BMP-2/4 antagonist in vitro. BMPR-IA is ubiquitously expressed during embryogenesis. In adult tissues, BMPR-IA mRNA is also widely distributed; with the highest expression levels found in skeletal muscle. The extracellular domain of BMPR-IA shares little amino acid sequence identity with the other mammalian ALK type I receptor kinases, but the cysteine residues are conserved. Human and mouse BMPR-IA are highly conserved and share 98% sequence identity. |
Protein Sequence | QNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRHHHHHH |
Uniprot ID | P36894 |
Protein RefSeq | NP_004320.2 |
mRNA RefSeq | NM_004329.2 |
Figures
![SDS-PAGE recombinant human BMPR-1A](/fileadmin/user_upload/products/BMPR/S01-021_Silverstain.jpg)
SDS-PAGE analysis of recombinant human soluble BMPR-1A from insect cells. Sample was loaded in 15% SDS-polyacrylamide gel under reducing condition and visualized with Silver stain.
![](/fileadmin/user_upload/products/BMPR/S01-021_Inhibition_C2C12.png)
Inhibition of BMP-2 induced proliferation of C2C12 cells with recombinant human BMPR-1A. C2C12 cells were plated with 1500cells/well in a 96well plate. Cells were stimulated with 0.5μg/ml BMP-2 [Cat# 200-001] and increasing amounts of recombinant human soluble BMPR-1A [Cat# S01-021] were added. The cells were incubated at 37°C, 5% CO2 for 4 days.
All prices plus VAT + possible delivery charges