Rabbit Prolactin
Slide this table
Cat-Nr. | 500-088S |
Size | 10 µg |
Price | 190 € |
Category | Cytokines & Growth Factors |
Source | E. coli |
Species Reactivity | Rabbit |
Formulation | lyophilized |
Purity Confirmation | > 98% by SDS-PAGE & HPLC analyses |
Length [aa] | 199 |
Molecular Weight | 23.0 kDa |
N Terminal Sequence | APICP |
Reconstitution | It is recommended to reconstitute the lyophilized rbPRL in sterile 0.04% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Synonyms | Mammotropin, Luterotropic hormone, Lutetropin |
Description | Recombinant rabbit prolactin, one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 23 kDa, was purified by proprietary chromatographic techniques (unpublished data). |
Protein Sequence | APICPSGAVNCQVSLRDLFDRAVILSHHIHKLSSEMFNEFDKRYTQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEDLLNMVLRVLPSWNDPLYHLVTEVRGMQEAPDAILSKAIEIEEQNRRLLEGMEKIVGQVHPGIKENEIYSVWSGLPSLQMADEDARLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC |
Uniprot ID | Q28632 |
Protein RefSeq | NP_001076144.1 |
mRNA RefSeq | NM_001082675.1 |
All prices plus VAT + possible delivery charges