Rabbit Prolactin
Slide this table
| Cat-Nr. | 500-088 |
| Size | 50 µg |
| Price | 295 € |
| Category | Cytokines & Growth Factors |
| Source | E. coli |
| Species Reactivity | Rabbit |
| Formulation | lyophilized |
| Purity Confirmation | > 98% by SDS-PAGE & HPLC analyses |
| Length [aa] | 199 |
| Molecular Weight | 23.0 kDa |
| N Terminal Sequence | APICP |
| Reconstitution | It is recommended to reconstitute the lyophilized rbPRL in sterile 0.04% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Synonyms | Mammotropin, Luterotropic hormone, Lutetropin |
| Description | Recombinant rabbit prolactin, one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 23 kDa, was purified by proprietary chromatographic techniques (unpublished data). |
| Protein Sequence | APICPSGAVNCQVSLRDLFDRAVILSHHIHKLSSEMFNEFDKRYTQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEDLLNMVLRVLPSWNDPLYHLVTEVRGMQEAPDAILSKAIEIEEQNRRLLEGMEKIVGQVHPGIKENEIYSVWSGLPSLQMADEDARLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC |
| Uniprot ID | Q28632 |
| Protein RefSeq | NP_001076144.1 |
| mRNA RefSeq | NM_001082675.1 |
All prices plus VAT + possible delivery charges