Ovine Prolactin
Slide this table
Cat-Nr. | 500-085 |
Size | 50 µg |
Price | 295 € |
Category | Cytokines & Growth Factors |
Source | E. coli |
Species Reactivity | Ovine |
Formulation | lyophilized |
Purity Confirmation | > 99% by SDS-PAGE & HPLC analyses |
Length [aa] | 199 |
Molecular Weight | 23.0 kDa |
N Terminal Sequence | ATPVCP |
Reconstitution | It is recommended to reconstitute the lyophilized oPRL in sterile water or 0.4% NaHCO3 adjusted tp pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein. |
Synonyms | Mammotropin, Luterotropic hormone, Lutetropin |
Description | Recombinant ovine prolactin, one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 23 kDa, was purified by proprietary chromatographic techniques (see Leibovich et al., Protein Expr Purif. 2001 22:489-96). |
Protein Sequence | ATPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC |
Uniprot ID | P01240 |
Protein RefSeq | NP_001009306.1 |
mRNA RefSeq | NM_001009306.1 |
All prices plus VAT + possible delivery charges