Chicken Prolactin, pegylated
Slide this table
| Cat-Nr. | 500-084S |
| Size | 10 µg |
| Price | 210 € |
| Category | Cytokines & Growth Factors |
| Source | E. coli |
| Label | PEG |
| Species Reactivity | Chicken |
| Formulation | lyophilized |
| Purity Confirmation | > 99% by SDS-PAGE & HPLC analyses |
| Length [aa] | 199 |
| Molecular Weight | 39.0 kDa |
| N Terminal Sequence | ALPICP |
| Reconstitution | It is recommended to reconstitute the lyophilized pegylated chPRL in sterile water or 0.4% NaHCO3 adjusted tp pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein. |
| Synonyms | Mammotropin, Luterotropic hormone, Lutetropin |
| Description | Recombinant chicken prolactin, consists of one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids was mono-pegylated and purified by proprietary chromatographic techniques as described by Oclon et al. (in press). Its molecular mass is ~ 39 kDa, however under non-denaturing conditions it behaves as 220 kDa protein due to its increased hydrodynamic volume. |
| Protein Sequence | ALPICPIGSVNCQVSLGELFDRAVKLSHYIHYLSSEIFNEFDERYAQGRGFITKAVNGCHTSSLTTPEDKEQAQQIHHEDLLNLVVGVLRSWNDPLIHLASEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIVGRVHSGDAGNEIYSHWDGLPSLQLADEDSRLFAFYNLLHCLRRDSHKIDNYLKVLKCRLIHDSNC |
| Uniprot ID | P14676 |
| Protein RefSeq | NP_990797.2 |
| mRNA RefSeq | NM_205466.3 |
All prices plus VAT + possible delivery charges