Tialpia Leptin B
Slide this table
Cat-Nr. | 500-075S |
Size | 100 µg |
Price | 295 € |
Category | Cytokines & Growth Factors |
Source | E. coli |
Species Reactivity | Tilapia |
Formulation | lyophilized |
Purity Confirmation | > 95.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 133 |
Molecular Weight | 14.6 kDa |
N Terminal Sequence | ALLTKG |
Reconstitution | It is recommended to reconstitute the lyophilized recombinant Tilapia leptin B in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
Synonyms | Lep; ob; obese |
Description | Full‐length cDNA encoding two leptin sequences (tLepA and tLepB) were identified in tilapia (Oreochromis niloticus). The cDNAs of tLepA and tLepB were 486 bp and 459 bp in length, encoding proteins of 161 aa and 152 aa, respectively. The tLepB ‐expressing plasmid was transformed into E. coli and expressed as recombinant proteins upon induction with nalidixic acid, found almost entirely in insoluble inclusion bodies (IBs). The protein was solubilized, refolded and purified to homogeneity by anion‐exchange chromatography. More information can be found in Shpilman et al. (2014) General and Comparative Endocrinology 270, 74-85. |
Protein Sequence | ALLTKGESIKNTIHNIVNIAQITLVHIKKLKLPATPTEVPTPSIDGLSSISHDLGVLDNELQHPFLIQIQADVSSLEGRVRSFALSMECPLKPKPAVQTDESVFPDSRLYMTVAKVQHYLEKLILNKGKLKLC |
Uniprot ID | A0A067Z7V9 |
Protein RefSeq | NP_001287978.1 |
mRNA RefSeq | NM_001301049.1 |
All prices plus VAT + possible delivery charges