Rabbit Leptin
Slide this table
| Cat-Nr. | 500-072 |
| Size | 500 µg |
| Price | 510 € |
| Category | Cytokines & Growth Factors |
| Source | E. coli |
| Species Reactivity | Rabbit |
| Formulation | lyophilized |
| Purity Confirmation | > 97.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 146 |
| Molecular Weight | 16.0 kDa |
| N Terminal Sequence | AVPI |
| Reconstitution | It is recommended to reconstitute the lyophilized recombinant rabbit leptin in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Synonyms | Lep; ob; obese |
| Description | Recombinant rabbit leptin, is one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. Recombinant rabbit leptin was purified by proprietary chromatographic techniques, (Solomon, Charlier, Djiane and Gertler,. unpublished results) |
| Protein Sequence | AVPMRKVQDDTKTLIKTIVTRISDISHTQSVSSRQRVVGLDFIPGLHPNLSLSTMDQTLAIYQQILASLPSRNVIQIANDLENLRDLLHLLASSKSCPLPRASGLETLEGLGGVLEASLYSTEVVALSRLQGFLQAMLQQLDLGPGC |
| Uniprot ID | B0KZL0 |
| Protein RefSeq | NP_001156541.1 |
| mRNA RefSeq | NM_001163069.1 |
All prices plus VAT + possible delivery charges