Porcine Leptin
Slide this table
Cat-Nr. | 500-070S |
Size | 100 µg |
Price | 210 € |
Category | Cytokines & Growth Factors |
Source | E. coli |
Species Reactivity | Porcine |
Formulation | lyophilized |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 146 |
Molecular Weight | 16.0 kDa |
N Terminal Sequence | AVIPW |
Reconstitution | It is recommended to reconstitute the lyophilized recombinant porcine leptin in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Synonyms | Lep; ob; obese |
Description | Recombinant porcine leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa, Recombinant porcine leptin was purified by proprietary chromatographic techniques, see Raver et al. Prot. Express. Purif. 19, 30-40 (2000). |
Protein Sequence | AVPIWRVQDDTKTLIKTIVTRISDISHMQSVSSKQRVTGLDFIPGLHPVLSLSKMDQTLAIYQQILTSLPSRNVIQISNDLENLRDLLHLLASSKSCPLPQARALETLESLGGVLEASLYSTEVVALSRLQGALQDMLRQLDLSPGC |
Uniprot ID | Q29406 |
Protein RefSeq | NP_999005.1 |
mRNA RefSeq | NM_213840.1 |
All prices plus VAT + possible delivery charges