Ovine Leptin R4C mutant
Slide this table
| Cat-Nr. | 500-064 |
| Size | 500 µg |
| Price | 510 € |
| Category | Cytokines & Growth Factors |
| Source | E. coli |
| Species Reactivity | Ovine |
| Formulation | lyophilized |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 146 |
| Molecular Weight | 16.0 kDa |
| N Terminal Sequence | ACPIC |
| Reconstitution | It is recommended to reconstitute the lyophilized recombinant ovine leptin R4C mutant in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Synonyms | Lep; ob; obese |
| Description | Recombinant ovine leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. The wild type leptin was mutated at position 4 replacing arginine by cysteine. Recombinant ovine leptin R4C mutant was purified by proprietary chromatographic techniques, see Reicher et al. J. Animal Sciences 90:410-418 (2012). |
| Protein Sequence | AVPCRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG |
| Protein RefSeq | XP_027824581.2 |
| mRNA RefSeq | XM_027968780.2 |
All prices plus VAT + possible delivery charges