Chicken Leptin
Slide this table
Cat-Nr. | 500-058S |
Size | 100 µg |
Price | 210 € |
Category | Cytokines & Growth Factors |
Source | E. coli |
Species Reactivity | Chicken |
Formulation | lyophilized |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 146 |
Molecular Weight | 16.0 kDa |
N Terminal Sequence | AVPCQ |
Reconstitution | It is recommended to reconstitute the lyophilized recombinant chicken leptin in sterile water or 0.4% NaHCO3 adjusted tp pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Synonyms | Lep; ob; obese |
Description | Recombinant chicken leptin is an one polypeptide chain containing 145 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. Chicken leptin was prepared according to the sequence published by the groups of Taouis and McMutry, purified by proprietary chromatographic techniques, see Raver et al. Protein Expr Purif. 1998 Dec; 14(3):403-8. |
Protein Sequence | AVPCQIFQDDTKTLIKTIVTRINDISHTSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDISPEC |
Uniprot ID | O42164 |
Protein RefSeq | APC23099.1 |
mRNA RefSeq | KT970642.1 |
All prices plus VAT + possible delivery charges