Bovine Leptin
Slide this table
Cat-Nr. | 500-057S |
Size | 100 µg |
Price | 210 € |
Category | Cytokines & Growth Factors |
Source | E. coli |
Species Reactivity | Rat |
Formulation | lyophilized |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 146 |
Molecular Weight | 16.0 kDa |
N Terminal Sequence | AVPIR |
Reconstitution | It is recommended to reconstitute the lyophilized recombinant bovine leptin in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Synonyms | Lep; ob; obese |
Description | Recombinant bovine leptin is an one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. Bovine leptin was purified by proprietary chromatographic techniques, see Raver et al. Prot. Express. Purif. 19, 30-40 (2000). |
Protein Sequence | AVPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPLLSLSKMDQTLAIYQQILTSLPSRNVVQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPGC |
Uniprot ID | P50595 |
Protein RefSeq | NP_776353.2 |
mRNA RefSeq | NM_173928.2 |
All prices plus VAT + possible delivery charges