Rat Leptin super antagonist (mutant D23L/L39A/D40A/F41A)
Slide this table
| Cat-Nr. | 500-055 |
| Size | 100 µg |
| Price | 295 € |
| Category | Cytokines & Growth Factors |
| Source | E. coli |
| Species Reactivity | Rat |
| Formulation | lyophilized |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 146 |
| Molecular Weight | 16.0 kDa |
| N Terminal Sequence | AVPIQ |
| Reconstitution | It is recommended to reconstitute the lyophilized super rat leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
| Synonyms | Lep; ob; obese |
| Description | Recombinant super rat leptin antagonist is one polypeptide chain containing 146 amino. Super rat leptin antagonist (SRLA) was initially mutated, resulting in D23L/L39A/D40A/F41A super rat leptin antagonist that was purified by proprietary chromatographic techniques. The procedure was similar to that described in in Shpilman at al., J. Biol. Chem. 286:4439-42 (2011) for mouse super leptin antagonist. |
| Protein Sequence | AVPIHKVQDDTKTLIKTIVTRINLISHTQSVSARQRVTGAAAIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC |
| Uniprot ID | P50596 |
| Protein RefSeq | NP_037208 |
| mRNA RefSeq | NM_013076 |
All prices plus VAT + possible delivery charges