Rat Leptin, Pegylated
Slide this table
Cat-Nr. | 500-052 |
Size | 500 µg |
Price | 490 € |
Category | Cytokines & Growth Factors |
Source | E. coli |
Label | PEG |
Species Reactivity | Rat |
Formulation | lyophilized |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 146 |
Molecular Weight | 35.6 kDa |
Reconstitution | It is recommended to reconstitute the lyophilized recombinant rat leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
Synonyms | Lep; ob; obese |
Description | Mono-pegylated (with 20 kDa PEG) recombinant rat leptin is an one polypeptide chain containing 146 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 35.6 kDa as determined by MS. However due to enlarged hydrodymanic volume it runs on the SGS-Page as 48 kDa protein and in gel-filtration on Superdex 200 as over 100 kDa protein. The half-life in circulation of pegylated recombinant rat leptin after SC injection was over 20 hours. Recombinant rat leptin as purified by proprietary chromatographic techniques according to Salomon et al (2006) Protein Expression and Purification 47, 128–136 and then pegylated. |
Protein Sequence | AVPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC |
Uniprot ID | P50596 |
Protein RefSeq | NP_037208 |
mRNA RefSeq | NM_013076 |
All prices plus VAT + possible delivery charges