Human Leptin antagonist (mutant L39A/D40A/F41A/I42A)
Slide this table
Cat-Nr. | 500-043S |
Size | 50 µg |
Price | 175 € |
Category | Cytokines & Growth Factors |
Source | E. coli |
Species Reactivity | Human |
Formulation | lyophilized |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 146 |
Molecular Weight | 16.0 kDa |
N Terminal Sequence | AVPIQ |
Reconstitution | It is recommended to reconstitute the lyophilized recombinant human leptin antagonist in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions preferably in presence of carrier protein. |
Synonyms | Lep; ob; obese |
Description | Recombinant human leptin is one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. Human leptin was mutated, resulting in L39A/D40A/F41A/I42A mutant which is leptin antagonist. It was purified by proprietary chromatographic techniques. Preparation of leptin antagonists was published (Niv-Spector et al, Biochem. J 291;221-230 (2005). |
Protein Sequence | AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGAAAAPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
Uniprot ID | P41159 |
Protein RefSeq | NP_000221.1 |
mRNA RefSeq | NM_000230 |
All prices plus VAT + possible delivery charges