Human Leptin pegylated antagonist (mutant L39A/D40A/F41A)
Slide this table
Cat-Nr. | 500-042S |
Size | 50 µg |
Price | 270 € |
Category | Cytokines & Growth Factors |
Source | E. coli |
Label | PEG |
Species Reactivity | Human |
Formulation | lyophilized |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 146 |
Molecular Weight | 35.6 kDa |
N Terminal Sequence | AVPIQ |
Reconstitution | It is recommended to reconstitute the lyophilized pegylated recombinant human pegylated leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
Synonyms | Lep; ob; obese |
Description | Mono-pegylated (with 20 kDa PEG) recombinant human leptin antagonist is one polypeptide chain containing 146 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 35.6 kDa as determined by MS. However due to enlarged hydrodymanic volume recombinant human leptin antagonist runs on the SDS-PAGE as 48 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. Human pegylated recombinant leptin antagonist half-life in circulation after SC injection was over 20 hours. Human pegylated recombinant leptin antagonist was initially mutated, resulting in L39A/D40A/F41A mutant that was purified by proprietary chromatographic techniques according to Niv-Spector et al, Biochem. J 291;221-230 (2005). and its pegylation was similar to that is described in Elinav et al. for mouse leptin antagonist see Endocrinology 150:3083-91 (2009). |
Protein Sequence | AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGAAAIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
Uniprot ID | P41159 |
Protein RefSeq | NP_000221.1 |
mRNA RefSeq | NM_000230 |
All prices plus VAT + possible delivery charges