Human Leptin N82K mutant
Slide this table
Cat-Nr. | 500-039S |
Size | 100 µg |
Price | 190 € |
Category | Cytokines & Growth Factors |
Source | E. coli |
Species Reactivity | Human |
Formulation | lyophilized |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 146 |
Molecular Weight | 16.0 kDa |
N Terminal Sequence | AVPIQ |
Reconstitution | It is recommended to reconstitute the lyophilized recombinant human leptin N82K mutant in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Synonyms | Lep; ob; obese |
Description | Recombinant protein - human leptin N82K mutant was produced by site specific mutagenesis. It consists of one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa., Human leptin mutant was purified by proprietary chromatographic techniques, see Niv-Spector et al. (2010) Mol Genet Metab. 100(2):193-7. It is devoid of biological activity and mey serve for control experiments. |
Protein Sequence | AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLEKLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
Uniprot ID | P41159 |
Protein RefSeq | NP_000221.1 |
mRNA RefSeq | NM_000230 |
All prices plus VAT + possible delivery charges