Rainbow trout Growth Hormone
Slide this table
Cat-Nr. | 500-021S |
Size | 10 µg |
Price | 190 € |
Category | Cytokines & Growth Factors |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE. |
Length [aa] | 188 |
Molecular Weight | 22.0 kDa |
N Terminal Sequence | AIENQR |
Reconstitution | It is recommended to reconstitute the lyophilized rtGH in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml and not more than 3 mg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein. |
Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
Description | Recombinant rainbow trout growth hormone (rtGH) produced in E. coli (22 K) is a single, non-glycosylated, polypeptide chain containing 188 amino acids with an additional Ala at its N-terminus and having a molecular mass of 21535 Dalton. rtGH is expressed as inclusion bodies, refolded and purified by proprietary chromatographic techniques. |
Protein Sequence | AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVDKHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLITGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL |
Uniprot ID | P09538 |
Protein RefSeq | NP_001118161.1 |
mRNA RefSeq | NM_001124689.1 |
All prices plus VAT + possible delivery charges