Fish (denis) Growth Hormone
Slide this table
Cat-Nr. | 500-020S |
Size | 10 µg |
Price | 190 € |
Category | Cytokines & Growth Factors |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE. |
Length [aa] | 188 |
Molecular Weight | 21.4 kDa |
N Terminal Sequence | AQPITDGQRL |
Reconstitution | It is recommended to reconstitute the lyophilized recombinant Gilthead Seabream growth hormone in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
Description | Recombinant Gilthead Seabream (Sparus aurata) growth hormone (gsGH) produced in E. coli (21.4 K) is a single, non-glycosylated, polypeptide chain containing 188 amino acids and having a molecular mass of ~ 21.392 kDa. Recombinant Gilthead Seabream growth hormone was purified by chromatographic techniques, according to Ben-Atia et al., General and Comparative Endocrinology 113, 155–164 (1999). |
Protein Sequence | AQPITDGQRLFSIAVSRVQHLHLLAQRLFSDFESSLQTEEQRQLNKIFLQDFCNSDYIISPIDKHETQRSSVLKLLSISYRLVESWEFPSRSLSGGSAPRNQISPKLSELKTGIHLLIRANEDGAEIFPDSSALQLAPYGNYYQSLGTDESLRRTYELLACFKKDMHKVETYLTVAKCRLSPEANCTL |
Uniprot ID | P29971 |
Protein RefSeq | AAB19750.2 |
mRNA RefSeq | S54890.1 |
All prices plus VAT + possible delivery charges