Fish (carp) Growth Hormone
Slide this table
Cat-Nr. | 500-019 |
Size | 50 µg |
Price | 295 € |
Category | Cytokines & Growth Factors |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 95.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel. |
Length [aa] | 188 |
Molecular Weight | 21.4 kDa |
N Terminal Sequence | SDNQRLF |
Reconstitution | It is recommended to reconstitute the lyophilized recombinant common carp growth hormone in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml and not more than 3 mg/ml. Recombinant common carp growth hormone can then be further diluted to other aqueous solutions, preferably in presence of carrier protein. |
Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
Description | Recombinant common carp (Cyprinus carpio) growth hormone (caGH) produced in E.Coli (21.4 K) is a single, non-glycosylated, polypeptide chain containing 188 amino acids and having a molecular mass of 21404 Da. Recombinant common carp growth hormone is purified by chromatographic techniques, according to Fine et al. General and Comparative Endocrinology, 89,51-61 (1993). |
Protein Sequence | SDNQRLFNNAVIRVQHLHQLAAKMINDFEDSLLPEERRQLSKIFPLSFCNSDYIEAPAGKDETQKSSMLKLLRISFHLIESWEFPSQSLSGTVSNSLTVGNPNQLTEKLADLKMGISVLIQACLDGQPNMDDNDSLPLPFEDFYLTMGENNLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL |
Uniprot ID | P10298 |
Protein RefSeq | XP_018951738.1 |
mRNA RefSeq | XM_019096193.2 |
All prices plus VAT + possible delivery charges