Chicken Growth Hormone
Slide this table
Cat-Nr. | 500-010 |
Size | 50 µg |
Price | 295 € |
Category | Cytokines & Growth Factors |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 99.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel. |
Length [aa] | 191 |
Molecular Weight | 22.2 kDa |
N Terminal Sequence | ATFPA |
Reconstitution | It is recommended to reconstitute the lyophilized chicken recombinant growth hormone in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml and not more than 3 mg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein. |
Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
Description | Chicken recombinant growth hormone (chGH) produced in E.Coli (22 K) is a single, non-glycosylated, polypeptide chain containing 191 amino acids with an additional Ala at its N-terminus and having a molecular mass of 22237 Dalton. For reference see Eliasiewicz et al. (2006) Ann N Y Acad Sci. 1091:501-508. |
Protein Sequence | ATFPAMPLSNLFANAVLRAQHLHLLAAETYKEFERTYIPEDQRYTNKNSQAAFCYSETIPAPTGKDDAQQKSDMELLRFSLVLIQSWLTPVQYLSKVFTNNLVFGTSDRVFEKLKDLEEGIQALMRELEDRSPRGPQLLRPTYDKFDIHLRNEDALLKNYGLLSCFKKDLHKVETYLKVMKCRRFGESNCTI |
Uniprot ID | P08998 |
Protein RefSeq | NP_989690.1 |
mRNA RefSeq | NM_204359.2 |
All prices plus VAT + possible delivery charges