human PDGF-AB protein Human 20 µg

Cat-Nr.
200-054
Size
20 µg
€193.00

Description / human PDGF-AB protein

PDGFs are disulfide-linked dimers consisting of two 12.0-13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs; PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. The PDGFs are stored in platelet α-granules and are released upon platelet activation. The PDGFs are involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. Two distinct signaling receptors used by PDGFs have been identified and named PDGFR-α and PDGFR-β. PDGFR-α is high-affinity receptor for each of the three PDGF forms. On the other hand, PDGFR-β interacts with only PDGF-BB and PDGF-AB. Recombinant human PDGF-AB is a 25.5 kDa disulfide-linked dimer, consisting of one A chain and one B chains (234 total amino acids).

Available sizes:

No. Size [µg]
200-053 5
200-054 20

 

More Information

Size 20 µg
Source E. coli
Biological Activity The biological activity was determined by the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts).
Purity Confirmation > 95% by SDS-PAGE
Endotoxin < 0.1 ng/µg of protein (< 1 EU/µg)
Length [aa] 125/109
Molecular Weight 25.5 kDa
Species Reactivity Human
Formulation lyophilized
Buffer 50mM acetic acid
Protein Sequence Alpha chain: SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT Beta chain: SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Reconstitution Centrifuge vial prior to opening. The lyophilized PDGF-AB should be reconstituted in 50mM acetic acid to a concentration not lower than 100μg/ml. For long term storage of reconstituted protein addition of carrier protein (e.g. BSA or HSA; 0.1%) is recomme
Stability and Storage The lyophilized PDGF-AB is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted PDGF-AB is best stored at -20°C to -70°C. Avoid repeated freeze-thaw cycles.
Synonyms PDGFA; PDGF1; PDGF-A
Uniprot ID P04085/P01127
Protein RefSeq NP_002599.1;NP_002598.4
mRNA RefSeq NM_002608.2;NM_002607.7

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.

All prices plus VAT + possible delivery charges